CD1C (T-cell Surface Glycoprotein CD1c, CD1C)

Size

£685.00

SKU:: 124559
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa77-185 from human CD1C (NP_001756) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4B11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Recognizes a polypeptide (CD1c) antigen of 43kD which is associated with the 12kD beta 2 microglobulin present on thymocytes, a subpopulation of B-lymphocytes early during ontogeny, Langerhans cells and dendritic cells. It may be useful for studies of calcium flux induced by CD1c. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.