CD1B (T-cell Surface Glycoprotein CD1b, CD1b)

Size

£685.00

SKU:: 124558
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa19-110 from human CD1B (NP_001755.1) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2E4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: CD1b is a 43kD member of the immunoglobulin superfamily also known as R1. It is a type I membrane glycoprotein with structural similarities to MHC class I and is non-covalently associated with B2-microglobulin. In humans, CD1 family consists of group I proteins (CD1a, CD1b, CD1c), group II (CD1d), and group III (CD1e). CD1b plays a role in non-peptide glycolipid antigen presentation to CD1-restricted T cells. It is expressed on cortical double positive and single positive thymocytes, Langerhans cells, and dendritic cells. In addition to antigen presentation, CD1b has been implicated in thymic T cell development. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDSDSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice