124558-BIOTIN
CD1B (T-cell Surface Glycoprotein CD1b, CD1b) (Biotin)
Size
£927.00
- SKU:
- 124558-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa19-110 from human CD1B (NP_001755.1) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2E4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- CD1b is a 43kD member of the immunoglobulin superfamily also known as R1. It is a type I membrane glycoprotein with structural similarities to MHC class I and is non-covalently associated with B2-microglobulin. In humans, CD1 family consists of group I proteins (CD1a, CD1b, CD1c), group II (CD1d), and group III (CD1e). CD1b plays a role in non-peptide glycolipid antigen presentation to CD1-restricted T cells. It is expressed on cortical double positive and single positive thymocytes, Langerhans cells, and dendritic cells. In addition to antigen presentation, CD1b has been implicated in thymic T cell development. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDSDSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKY Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice