124554-ML650
CD19 (B-lymphocyte Antigen CD19, B-lymphocyte Surface Antigen B4, Differentiation Antigen CD19, T-cell Surface Antigen Leu-12) (MaxLight 650)
Size
£914.00
- SKU:
- 124554-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa98-187 from human CD19 (NP_001761) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1C9
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. CD19 is a member of the immunoglobulin superfamily with 556aa and two immunoglobulin-like C2-type domains. As a cell surface protein, CD19 is known to form a complex with CD21, CD81 and CD225 in the membrane of mature B cells. A major function of CD19 is to assemble with the antigen receptor of B lymphocytes so as to decrease the threshold for antigen receptor dependent stimulation thus enhancing the specificity and sensitivity of B cells towards antigens. CD19 is an important protein for B cell antigen receptor signaling and regulation and also acts as a specialized adaptor protein for the amplification of Src family needed for this purpose. Regulation of growth of B cells is a major function of CD19 and its expression is confined to only B lymphocytes and follicular dendritic cells of the hematopoietic system. Increased expression of CD19 induces the production of auto-antibody thus giving an insight to the regulatory role of CD19 in autoimmunity. Defects in CD19 are a cause of hypogammaglobulinemia. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice