124551
CD178 (Apoptosis Antigen Ligand, APT1LG1, APTL, CD95 Ligand, CD95L, CD95-L, FAS Antigen Ligand, Fas Ligand, FASL, FASLG, Tumor Necrosis Factor Ligand Superfamily Member 6, TNFSF6)
Size
£760.00
- SKU:
- 124551
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human FASLG, aa1-281 (AAH17502.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- FAS Ligand (FASL) is a 40kD type II membrane protein belonging to the tumor necrosis factor family, which induces apoptosis by binding to its receptor, Fas. The human FasL gene consists of approximately 8kb and is split into four exons. This gene consists of 281aa with a calculated M(r) of 31,759 and was mapped on chromosome 1q23. It has an identity of 76.9% at the aa sequence level with mouse FasL. The FAS and FASL system plays a key role in regulating apoptotic cell death and corruption of this signalling pathway has been shown to participate in immune escape and tumorigenesis. FAS and FASL triggered apoptosis pathway plays an important role in human carcinogenesis. This system may also play a role in modulating the genetic susceptibility of mouse strains to develop T-cell lymphoblastic lymphomas. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice