124545-APC

CD164 (Sialomucin Core Protein 24, MUC-24, Endolyn, Multi-glycosylated Core Protein 24, MGC-24, MGC-24v) (APC)

Size

£927.00

SKU:: 124545-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1-115 from CD164 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4B4
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: CD164 is a member of the CD164 family of proteins and is highly N- and O-glycosylated. It has a Ser-Gly motif that may serve as the site of attachment of a glycosaminoglycan side chain. It contains sialic acid. CD164 may be associated with carcinoma and is probably a mucin. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTAT Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.