CD161 (NKR, NKR-PI, NKR-P1A, CLEC5B, Killer Cell Lectin like Receptor Subfamily B Member 1, KLRB1)

Size

£685.00

SKU:: 124544
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa126-225 from human KLRB1 (NP_002249) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2F3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Natural killer (NK) cells are lymphocytes that mediate cytotoxicity and secrete cytokines after immune stimulation. Several genes of the C-type lectin superfamily, including the rodent NKRP1 family of glycoproteins, are expressed by NK cells and may be involved in the regulation of NK cell function. The KLRB1 protein contains an extracellular domain with several motifs characteristic of C-type lectins, a transmembrane domain, and a cytoplasmic domain. The KLRB1 protein, NKR-P1A or D161, is classified as a type II membrane protein because it has an external C terminus.[1] NKR-P1A, the receptor encoded by the KLRB1 gene, recognizes Lectin Like Transcript-1 (LLT1) as a functional ligand. Human CD161 is a homodimeric disulfide-linked type II membrane bound glycoprotein found mainly on NK cells. CD161 has been implicated in the regulation of NK cell mediated cytotoxicity. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ESSLLLIRDKDELIHTQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEIRGDAKENSCISISQTSVYSEYCSTEIRWICQKELTPVRNKVYPDS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice