124543-PE
CD160 (CD160 Antigen, Natural Killer Cell Receptor BY55, BY55) (PE)
Size
£934.00
- SKU:
- 124543-PE
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full-length human CD160, aa1-181 (AAH14465.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Extra Details:
- CD160 is a 27kD member of Ig superfamily of molecules. It is expressed on select hematopoietic cell types, including CD56dimCD16+ cytotoxic NK cells, CD8+CD28 effector T cells, YdT cells, and restricted CD4+ T cells. It is a receptor for HLAC molecules, and its engagement induces CD160+ NK cells to both secrete IFN-Y plus TNF-A, and initiate a cytotoxic program. Human CD160 was originally identified as a 155aa pro-protein aa27-181. It contains a 132aa mature region aa27-159 and a C-terminal pro-segment that is cleaved to create a GPI linkage. The mature region possesses one V-type Ig-like domain aa27-122. CD160 is found as a soluble, disulfide-linked 80kD multimer (likely trimer) that is generated by proteolysis of the GPI-linked form. This 80kD form, plus others, are highly resistant to reduction. There is also a 100-110kD multimeric transmembrane (TM) form that is associated with activated NK cells. It contains a 55aa substitution for aa180-181, and shows a 20aa TM segment between aa163- 182. The TM form appears to have a splice variant that lacks aa25-133. Over aa27-159, human CD160 shares only 62% aa sequence identity with mouse CD160. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQAL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice