124540-BIOTIN

CD16 (CD16A, CD16a Antigen, Fc gamma R3, Fc gamma RIII alpha, Fc gamma RIII, Fc gamma RIIIa, FCRIIIA, FCGRIII, FCG3, FCGR3A, FCGR3A Protein, FcR10, FcR-10, FcRIII, FcRIIIa, IGFR3, IgG Fc Receptor III-2, Low Affinity Immunoglobulin gamma Fc Region Receptor III-A) (Biotin)

Size

£927.00

SKU:: 124540-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa17-254 from human FCGR3A (AAH17865) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: CD16 is a low affinity Fc receptor for immunoglobulin G. CD16 is expressed primarily on NK cells and neutrophils. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKDPQDK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.