CD153 (Tumor Necrosis Factor Ligand Superfamily Member 8, CD30 Ligand, CD30-L, CD30L, CD30LG, TNFSF8)

Size

£698.00

SKU:: 124537
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa153-234 from human TNFSF8 (NP_001235) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2E11
Format:: Supplied as a liquid in ascites fluid.
Extra Details:: CD153 is a 39-40kD type II membrane glycoprotein, also known as CD30 ligand or CD30L. This TNF superfamily member is expressed on activated T cells. CD153 has been reported to stimulate B-cell proliferation, antigen-specific antibody production, polyclonal immunoglobulin secretion, and T cell activation and proliferation. This antibody inhibits binding of CD153 to CD30. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.