CD142 (CD142 Antigen, Coagulation Factor III, F3, Tissue Factor, TF, TFA, Thromboplastin)

Size

£685.00

SKU:: 124532
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa45-154 from human F3 (AAH11029) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4G4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: CD142, a 45kD cell surface glycoprotein which is also known as Tissue Factor. CD142 expression can be induced on monocytes, macrophages and endothelial cells by various stimuli including interleukin 1, tumor necrosis factor and endotoxin. CD142 initiates the blood clotting cascade by binding coagulation Factor VIIa, which activates Factor IX or Factor X by specific limited proteolysis. CD142 also plays an important role in inflammation, angiogenesis, and the pathophysiology of atherosclerosis and cancer. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.