124532-BIOTIN
CD142 (CD142 Antigen, Coagulation Factor III, F3, Tissue Factor, TF, TFA, Thromboplastin) (Biotin)
Size
£927.00
- SKU:
- 124532-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa45-154 from human F3 (AAH11029) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4G4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- CD142, a 45kD cell surface glycoprotein which is also known as Tissue Factor. CD142 expression can be induced on monocytes, macrophages and endothelial cells by various stimuli including interleukin 1, tumor necrosis factor and endotoxin. CD142 initiates the blood clotting cascade by binding coagulation Factor VIIa, which activates Factor IX or Factor X by specific limited proteolysis. CD142 also plays an important role in inflammation, angiogenesis, and the pathophysiology of atherosclerosis and cancer. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice