124519-ML490
CD11B (Integrin alpha-M, CD11 Antigen-like Family Member B, CR-3 alpha Chain, Cell Surface Glycoprotein MAC-1 Subunit alpha, Leukocyte Adhesion Receptor MO1, Neutrophil Adherence Receptor, ITGAM, CR3A, MGC117044) (MaxLight 490)
Size
£914.00
- SKU:
- 124519-ML490
- Application:
- FLISA
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa111-220 from human ITGAM (NP_000623) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4E10
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. CD11b is a 165-170kD type I transmembrane glycoprotein also known as aM integrin, Mac-1, CR3, and C3biR. CD11b non-covalently associates with integrin b2 (CD18) and is expressed on granulocytes, monocytes/macrophages, dendritic cells, NK cells, and subsets of T and B cells. CD11b/CD18 is critical for the transendothelial migration of monocytes and neutrophils. The ICRF44 antibody inhibits granulocyte activation in response to fMLP. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: QTCSENTYVKGLCFLFGSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQ Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice