124519-HRP

CD11B (Integrin alpha-M, CD11 Antigen-like Family Member B, CR-3 alpha Chain, Cell Surface Glycoprotein MAC-1 Subunit alpha, Leukocyte Adhesion Receptor MO1, Neutrophil Adherence Receptor, ITGAM, CR3A, MGC117044) (HRP)

Size

£914.00

SKU:: 124519-HRP
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa111-220 from human ITGAM (NP_000623) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4E10
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Extra Details:: CD11b is a 165-170kD type I transmembrane glycoprotein also known as aM integrin, Mac-1, CR3, and C3biR. CD11b non-covalently associates with integrin b2 (CD18) and is expressed on granulocytes, monocytes/macrophages, dendritic cells, NK cells, and subsets of T and B cells. CD11b/CD18 is critical for the transendothelial migration of monocytes and neutrophils. The ICRF44 antibody inhibits granulocyte activation in response to fMLP. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: QTCSENTYVKGLCFLFGSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQ Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice