CD106 (CD106 Antigen, DKFZp779G2333, INCAM 100, INCAM-100, L1CAM, MGC99561, Vascular Cell Adhesion Molecule 1, VCAM 1, VCAM1, VCAM-1, Vascular Cell Adhesion Protein 1)

Size

£685.00

SKU:: 124512
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa23-132 from human L1CAM (NP_000416) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3B10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: VCAM-1, which is present on activated endothelial cells. VCAM-1 is an adhesion molecule, which binds to the integrin alpha4/beta1 (VLA-4) and to the integrin alpha4/beta7 on lymphocytes. This antibody has been shown to inhibit T lymphocyte adhesion to TNF stimulated endothelial cells. The molecular weight of the recognized antigen is 110kD. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PEEYEGHHVMEPPVITEQSPRRLVVFPTDDISLKCEASGKPEVQFRWTRDGVHFKPKEELGVTVYQSPHSGSFTITGNNSNFAQRFQGIYRCFASNKLGTAMSHEIRLMA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.