124512-FITC
CD106 (CD106 Antigen, DKFZp779G2333, INCAM 100, INCAM-100, L1CAM, MGC99561, Vascular Cell Adhesion Molecule 1, VCAM 1, VCAM1, VCAM-1, Vascular Cell Adhesion Protein 1) (FITC)
Size
£914.00
- SKU:
- 124512-FITC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa23-132 from human L1CAM (NP_000416) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3B10
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Extra Details:
- VCAM-1, which is present on activated endothelial cells. VCAM-1 is an adhesion molecule, which binds to the integrin alpha4/beta1 (VLA-4) and to the integrin alpha4/beta7 on lymphocytes. This antibody has been shown to inhibit T lymphocyte adhesion to TNF stimulated endothelial cells. The molecular weight of the recognized antigen is 110kD. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PEEYEGHHVMEPPVITEQSPRRLVVFPTDDISLKCEASGKPEVQFRWTRDGVHFKPKEELGVTVYQSPHSGSFTITGNNSNFAQRFQGIYRCFASNKLGTAMSHEIRLMA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice