124479-BIOTIN
Cyclin E2 (G1/S-specific Cyclin-E2, CCNE2) (Biotin)
Size
£934.00
- SKU:
- 124479-BIOTIN
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human CCNE2, aa1-404 (NP_477097.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Cyclin E2, a 404aa protein, is a member of highly conserved E-type G1-cyclin family. Cyclins bind to and activate CDK kinases to form serine/threonine kinase holoenzyme complexes that regulate eukaryotic cell cycle. Cyclin E2 is localized in the nucleus and shares significant homology with Cyclin E and its expression revolves throughout the cell cycle, with peak expression during G1-S phase. Cyclin E2 binds to and acts as a regulatory subunit of CDK2. It controls the G1-S phase transition during cell cycle and regulates the activity of CIP/KIP family of CDK inhibitors. Its expression is abnormally up-regulated in certain tumors suggesting a possible therapeutic intervention. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKKESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDINKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCPVTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTHTNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice