CCNDBP1 (Cyclin-D1-binding Protein 1, Grap2 and Cyclin-D-interacting Protein, Human Homolog of Maid, DIP1, GCIP, HHM)

Size

£685.00

SKU:: 124478
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa261-361 from CCNDBP1 (NP_036274) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3B7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: May negatively regulate cell cycle progression. May act at least in part via inhibition of the cyclin-D1/CDK4 complex, thereby preventing phosphorylation of RB1 and blocking E2F-dependent transcription. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LVAENGKKDQVAQMADIVDISDEISPSVDDLALSIYPPMCHLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQSELEL* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.