CCL3 (C-C Motif Chemokine 3, G0/G1 Switch Regulatory Protein 19-1, Macrophage Inflammatory Protein 1-alpha, MIP-1-alpha, PAT 464.1, SIS-beta, Small-inducible Cytokine A3, Tonsillar Lymphocyte LD78 alpha Protein, G0S19-1, MIP1A, SCYA3)

Size

£685.00

SKU:: 124466
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length human CCL3, aa1-92 (NP_002974).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap/