CCL26 (CC Chemokine IMAC, Thymic Stroma Chemokine-1, TSC-1, Macrophage Inflammatory Protein 4-alpha, MIP-4-alpha, Eotaxin-3, Small-inducible Cytokine A26, C-C Motif Chemokine 26, SCYA26, UNQ216/PRO242)

Size

£760.00

SKU:: 124464
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full-length human CCL26, aa1-94 (NP_006063.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Chemotactic for eosinophils and basophils. Binds to CCR3. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.