CCL24 (C-C Motif Chemokine 24, CK-beta-6, Eosinophil Chemotactic Protein 2, Eotaxin-2, Myeloid Progenitor Inhibitory Factor 2, MPIF-2, Small-inducible Cytokine A24, MPIF2, SCYA24)

Size

£760.00

SKU:: 124462
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human CCL24, aa1-119 (NP_002982.2).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Eotaxin 2 is an eosinophil-specific chemokine which is expressed principally by the jejunum and spleen. Expression is induced by allergen challenge. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.