CCL19 (C-C Motif Chemokine 19, Small Inducible Cytokine A19, Macrophage Inflammatory Protein 3 beta, MIP-3-beta, Epstein-Barr Virus-induced Molecule 1 Ligand Chemokine, EBI1-ligand Chemokine, ELC, Beta Chemokine Exodus-3, CK beta-11, MIP3B, SCYA19, MGC34433)

Size

£698.00

SKU:: 124452
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant corresponding to aa1-99 from human CCL19 with GST tag.
Clone:: 3E9
Format:: Supplied as a liquid in ascites fluid.
Extra Details:: The gene for CCL19 is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. CCL19 may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.