124451-FITC
CCL18 (C-C Motif Chemokine 18, Alternative Macrophage Activation-associated CC Chemokine 1, AMAC-1, CC Chemokine PARC, Dendritic Cell Chemokine 1, DC-CK1, Macrophage Inflammatory Protein 4, MIP-4, Pulmonary and Activation-regulated Chemokine, Small-inducible Cytokine A18, AMAC1, DCCK1, MIP4, PARC, SCYA18) (FITC)
Size
£914.00
- SKU:
- 124451-FITC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa21-89 from human CCL18 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2C6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Extra Details:
- Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses. Applications: Suitable for use in FLISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice