CCL13 (C-C Motif Chemokine 13, CK-beta-10, Monocyte Chemoattractant Protein 4, Monocyte Chemotactic Protein 4, MCP-4, NCC-1, Small-inducible Cytokine A13, MCP4, NCC1, SCYA13, MGC17134)

Size

£685.00

SKU:: 124440
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length human CCL13, aa1-98 (NP_005399.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: CCL13 is a small cytokine belonging to the CC chemokine family that is also known as thymus and activation regulated chemokine (TARC). This protein induces chemotaxis in monocytes, eosinophils, T lymphocytes, and basophils by binding cell surface G-protein linked chemokine receptors such as CCR2, CCR3 and CCR5. It can be induced by the inflammatory cytokines interleukin-1 and TNF-a. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.