CCL1 (C-C Motif Chemokine 1, Small-inducible Cytokine A1, T Lymphocyte-secreted Protein I-309, SCYA1)

Size

£685.00

SKU:: 124437
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa24-97 from human CCL1 (NP_002972) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4E4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Cytokine that is chemotactic for monocytes but not for neutrophils. Binds to CCR8. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.