124436
CCL1 (C-C Motif Chemokine 1, Small-inducible Cytokine A1, T Lymphocyte-secreted Protein I-309, SCYA1)
Size
£760.00
- SKU:
- 124436
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human CCL1, aa1-96 (NP_002972.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- Cytokine that is chemotactic for monocytes but not for neutrophils. Binds to CCR8. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice