CCDC5 (HAUS Augmin-like Complex Subunit 1, Coiled-coil Domain-containing Protein 5, Enhancer Of Invasion-Cluster, HEI-C, HAUS1, HEIC, FLJ21094, FLJ40084)

Size

£685.00

SKU:: 124429
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa179-279 from human CCDC5 (NP_612452) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1E3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: CCDC5 is regulator of spindle function and integrity during the metaphase-anaphase transition. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RQNMDFLKAKSEEFRFGIKAAEEQLSARGMDASLSHQSLVALSEKLARLKQQTIPLKKKLESYLDLMPNPSLAQVKIEEAKRELDSIEAELTRRVDMMEL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.