124379-APC
Caveolin 3 (Caveolin-3, CAV3, M-caveolin) (APC)
Size
£927.00
- SKU:
- 124379-APC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-83 from human CAV3 (NP_001225) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1G11
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Extra Details:
- Caveolin proteins are components of caveolae plasma membranes found in most cell types. Caveolin-3 is the muscle-specific form of the caveolin protein family whose members are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules within the caveolae membranes. Mutations in caveolin-3 have been isolated which interfere with caveolin-3 oligomerization and disrupt caveolae formation resulting in limb-girdle muscular dystrophy. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVP Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice