CASP10 (Caspase-10, CASP-10, ICE-like Apoptotic Protease 4, Apoptotic Protease Mch-4, FAS-associated Death Domain Protein Interleukin-1B-converting Enzyme 2, FLICE2, Caspase-10 Subunit p23/17, Caspase-10 Subunit p12, MCH4)

Size

£685.00

SKU:: 124353
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-110 from human CASP10 (NP_116756) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2E7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Caspases are death effector domain-containing cysteine aspartases presumed to be at or near the apex of apoptotic signaling pathways. All known isoforms of Caspase-10 are abundantly expressed in fetal lung, kidney, and skeletal muscle but are very poorly expressed or absent in these tissues in the adult, implying a possible role for the Caspase-10 family in fetal development. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.