124323-HRP
CAPN3 (Calpain-3, Calpain L3, Calpain p94, Calcium-activated Neutral Proteinase 3, CANP 3, Muscle-specific Calcium-activated Neutral Protease 3, New Calpain 1, nCL-1, NCL1, CANPL3, CANP3) (HRP)
Size
£914.00
- SKU:
- 124323-HRP
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa210-309 from human CAPN3 (AAH03169.1) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1B2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Extra Details:
- CAPN3, a heterodimer consisting of a large and a small subunit, is a major intracellular protease, although its function has not been well established. The protein is a muscle-specific member of the calpain large subunit family that specifically binds to titin. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice