124308-FITC

TIP120A (Cullin-associated NEDD8-dissociated Protein 1, Cullin-associated And Neddylation-dissociated Protein 1, p120 CAND1, TBP-interacting Protein TIP120A, TBP-interacting Protein of 120kD A, TIP120, KIAA0829, CAND1, DKFZp434M1414, FLJ10114, FLJ10929, FLJ38691, FLJ90441) (FITC)

Size

£914.00

SKU:: 124308-FITC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-101 from human CAND1 (NP_060918) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5D7
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Extra Details:: TIP120A enhances transcription from various types of promoters. It is regulatory protein that interferes with the assembly of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex and thereby down-regulates ubiquitination of target proteins. It prevents neddylation of CUL1 by physically blocking access to the neddylation site and disrupts interactions between CUL1 and SKP1A and between CUL1 and F-box proteins. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice