CAMK2A (Calcium/Calmodulin-dependent Protein Kinase Type II Subunit alpha, CaM-kinase II Subunit alpha, CaM Kinase II Subunit alpha, CAMKA, KIAA0968)

Size

£685.00

SKU:: 124286
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa305-410 from human CAMK2A (AAH40457) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: CaMKII is a member of calcium/calmodulin-activated kinase, functioning in neural synaptic stimulation and T-cell receptor signaling. CaMKII has catalytic and regulatory domains. The binding of Ca++/calmodulin to its regulatory domain releases its autoinhibitory effect and activates the kinase. The activated CaMKII further autophosphorylates itself at Thr286 to render the kinase constitutively active. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: TTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.