CAMK1D (Calcium/Calmodulin-dependent Protein Kinase ID, Calcium/calmodulin-dependent Protein kinase type 1D, CaM-K1, Camk1D, CaMKID, CaMKI delta, CaMKI-delta, CaM-KI delta, CamKI-like protein kinase, CaM kinase ID, CaM kinase I delta, CKLiK)

Size

£685.00

SKU:: 124281
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-96 from human CAMK1D (AAH35745) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3H8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: CAMK1-Like kinase belongs to the CAMK1 subfamily of Serine/Threonine Kinases. CAMK1-Like kinase is a polymorphonuclear leukocyte - specific kinase that mediates the regulation of granulocyte functions. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPNHLY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.