124269
CALNA2 (Calmodulin-dependent Calcineurin A Subunit, beta Isoform, Serine/Threonine Protein Phosphatase 2B Catalytic Subunit, beta Isoform, CAM-PRP Catalytic Subunit, PPP3CB, CNA2)
Size
£685.00
- SKU:
- 124269
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa435-524 from human PPP3CB (NP_066955) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 5D3
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- PPP3CB is a calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice