Calcium Sensing Receptor (Calcium-sensing Receptor, CASR, CAR, EIG8, Extracellular Calcium-sensing Receptor, FHH, FIH, GPRC2A, HHC, HHC1, MGC138441, NSHPT, Parathyroid Cell Calcium-sensing Receptor, PCaR1)

Size

£685.00

SKU:: 124251
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa21-120 from human CASR (NP_000379) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3F12
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: The calcium-sensing receptor (CaSR) is an integral membrane protein that is a member of the G protein-coupled receptor family. It senses changes in the extracellular concentration of calcium ions. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. Most cell lines do not express endogenous Ca++ sensing receptor. Studies have been done with HEK-293 or MDCK cells stabily or transiently expressed lysates. This protein is also found in native tissues. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.