124251-FITC
Calcium Sensing Receptor (Calcium-sensing Receptor, CASR, CAR, EIG8, Extracellular Calcium-sensing Receptor, FHH, FIH, GPRC2A, HHC, HHC1, MGC138441, NSHPT, Parathyroid Cell Calcium-sensing Receptor, PCaR1) (FITC)
Size
£914.00
- SKU:
- 124251-FITC
- Application:
- FLISA
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa21-120 from human CASR (NP_000379) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3F12
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Extra Details:
- The calcium-sensing receptor (CaSR) is an integral membrane protein that is a member of the G protein-coupled receptor family. It senses changes in the extracellular concentration of calcium ions. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. Most cell lines do not express endogenous Ca++ sensing receptor. Studies have been done with HEK-293 or MDCK cells stabily or transiently expressed lysates. This protein is also found in native tissues. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKI Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice