124251-BIOTIN
Calcium Sensing Receptor (Calcium-sensing Receptor, CASR, CAR, EIG8, Extracellular Calcium-sensing Receptor, FHH, FIH, GPRC2A, HHC, HHC1, MGC138441, NSHPT, Parathyroid Cell Calcium-sensing Receptor, PCaR1) (Biotin)
Size
£927.00
- SKU:
- 124251-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa21-120 from human CASR (NP_000379) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3F12
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- The calcium-sensing receptor (CaSR) is an integral membrane protein that is a member of the G protein-coupled receptor family. It senses changes in the extracellular concentration of calcium ions. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. Most cell lines do not express endogenous Ca++ sensing receptor. Studies have been done with HEK-293 or MDCK cells stabily or transiently expressed lysates. This protein is also found in native tissues. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKI Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice