124249-BIOTIN
Calcitonin Receptor (CALCR, CRT, CTR, CT-R, CTR1) (Biotin)
Size
£927.00
- SKU:
- 124249-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa394-474 from human CALCR with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2F7
- Format:
- Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Biotin.
- Extra Details:
- The Calcitonin Receptor (CALCR) inhibits bone resorption. This receptor is expressed during development and is involved in morphogenesis. Three alternatively spliced Calcitonin Receptor isoforms have been identified. In addition to binding calcitonin, the Calcitonin Receptor can complex with RAMP3 (receptor activity modifying protein) to bind amylin, which regulates pancreatic islet function and is involved in Type II diabetes. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: CNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARAAAAAAEAGDIPIYICHQELRNEPANNQGEESAEIIPLNIIEQESSA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice