Calcipressin 1 (DSCR1, Regulator Of Calcineurin 1, DSCR1, Down Syndrome Critical Region Protein 1, Myocyte-enriched Calcineurin-interacting Protein 1, MCIP1, Adapt78, RCAN1, DSC1, CSP1)

Size

£698.00

SKU:: 124246
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-100 from human DSCR1 (AAH02864) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1G7
Format:: Supplied as a liquid in ascites fluid.
Extra Details:: DSCR1 interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. The gene for this protein is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of DSCR1 may lead to neurofibrillary tangles such as those associated with Alzheimer disease. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEEVDLQDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.