124234-FITC
Cadherin N (Neural Cadherin, N-Cadherin, CDHN, NCAD, Cadherin 2 Type 1 N-Cadherin (Neuronal), Cadherin-2, CDH2, CD325, CD325 Antigen, CDw325) (FITC)
Size
£914.00
- SKU:
- 124234-FITC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa807-906 from human CDH2 (NP_001783) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 5C8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Extra Details:
- Cadherin-2 or Neural Cadherin is a member of the cadherin family of proteins that mediate calcium ion-dependent cell adhesion. Other members include E-cadherin and P-cadherin. Cadherin-2 is expressed in the brain and skeletal and cardiac muscle. Cadherin-2 has been identified as a potential prognostic marker for a number of tumors. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice