CACNA2D2 (KIAA0558, Voltage-dependent Calcium Channel Subunit alpha-2/delta-2, Voltage-gated Calcium Channel Subunit alpha-2/delta-2)

Size

£685.00

SKU:: 124208
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa65-162 from CACNA2D2 (NP_006021) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3A4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Cacna2d2 is an alpha subunit 2/delta regulatory subunit of the voltage-gated calcium channel. The human Cacna2d2 corresponds to the mouse mutant ducky phenotype, which is a model for absence epilepsy, characterized by seizures and ataxia. CACNA2D2 overexpression has been implicated in the apoptosis of NSCLC cells by changing the intracellular calcium concentration and disrupting the mitochondrial membrane. Applications: Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PQQHTMQHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIVYY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.