124200-ML490
CABIN1 (Calcineurin-binding Protein Cabin-1, Calcineurin Inhibitor, CAIN, KIAA0330) (MaxLight 490)
Size
£914.00
- SKU:
- 124200-ML490
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-111 from CABIN1 (NP_036427) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2G2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Calcineurin is a widely distributed Ser/Thr, calcium and calmodulin-dependent protein phosphatase. It mediates the immunosuppressive actions of drugs such as FK506 and cyclosporin, and has also been implicated in a number of calcium-sensitive pathways in the nervous system. Calcineurin has been found to be associated with other proteins, such as calmodulin, FKBP12, the ryanodine receptor, inositol 1,4,5-trisphosphate, and a recently identified protein, calcineurin inhibitor (CAIN). CAIN has been shown to bind calcineurin through its C-terminal tail. Recent studies have shown CAIN to bind to both amphiphysin 1 and calcineurin simultaneously and therefore acts as a physiological inhibitor of calcineurin. The binding of CAIN to amphiphysin 1 does not affect the interaction of amphiphysin 1 with other endocytic proteins. CAIN, like calcineurin, is highly expressed in neurons and other tissues. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MIRIAALNASSTIEDDHEGSFKSHKTQTKEAQEAEAFALYHKALDLQKHDRFEESAKAYHELLEASLLREAVSSGDEKEGLKHPGLILKYSTYKNLAQLAAQREDLETAM* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice