NSMCE2 (E3 SUMO-protein Ligase NSE2, MMS21 Homolog, hMMS21, Non-structural Maintenance of Chromosomes Element 2 Homolog, Non-SMC Element 2 Homolog, C8orf36, MMS21, FLJ32440)

Size

£685.00

SKU:: 124161
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length human C8orf36, aa1-247 (NP_775956).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: The structural maintenance of chromosomes (SMC) family of proteins play essential roles in genomic stability. Nse1 and Nse2 are essential proteins and conserved from yeast to man and loss of function leads to similar terminal phenotypes to those observed for Smc5-6 inactivation. Data suggests that like Smc5-6, Nse1, and Nse2 function in the homologous recombination repair of DNA double strand breaks. Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MPGRSSSNSGSTGFISFSGVESALSSLKNFQACINSGMDTASSVALDLVESQTEVSSEYSMDKAMVEFATLDRQLNHYVKAVQSTINHVKEERPEKIPDLKLLVEKKFLALQSKNSDADFQNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDEDIIVTQSQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKKRHRHSE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.