C1D (MGC12261, MGC14659, SUNCOR, C1D DNA-binding Protein, Small Unique Nuclear Receptor Corepressor, Nuclear DNA-binding Protein)

Size

£685.00

SKU:: 124086
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-141 from C1D (AAH05235) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6H2
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: C1D is known as nuclear nucleic acid-binding protein C1D. C1D is a ubiquitously expressed nuclear matrix DNA-binding, and apoptosis-inducing protein, which acts as an activator of the DNA-dependent protein kinase (DNA-PK), and is implicated as a regulator of TRAX/Translin complex formation. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.