124077-BIOTIN

RNF213 (E3 Ubiquitin-protein Ligase RNF213, ALK Lymphoma Oligomerization Partner on Chromosome 17, Mysterin, RING Finger Protein 213, ALO17, C17orf27, KIAA1554, KIAA1618, MYSTR, MGC46622, MGC9929) (Biotin)

Size

£927.00

SKU:: 124077-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2016-2113 from human C17orf27 (NP_065965) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5C12
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Probable E3 ubiquitin-protein ligase that may play a role in angiogenesis. May also have an ATPase activity. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LSPENAKLLSTFLNQTGLDAFLLELHEMIILKLKNPQTQTEERFRPQWSLRDTLVSYMQTKESEILPEMASQFPEEILLASCVSVWKTAAVLKWNRE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.