BTBD1 (BTB/POZ Domain-containing Protein 1, Hepatitis C Virus NS5A-transactivated Protein 8, HCV NS5A-transactivated Protein 8, C15orf1, NS5ATP8)

Size

£685.00

SKU:: 124028
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa384-483 from human BTBD1 (NP_079514) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3E11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Probable substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EYEKKQTLGQNDTGFSCDGTANTFRVMFKEPIEILPNVCYTACATLKGPDSHYGTKGLKKVVHETPAASKTVFFFFSSPGNNNGTSIEDGQIPEIIFYT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.