123998-BIOTIN

BRD8 (Bromodomain-containing Protein 8, Skeletal Muscle Abundant Protein, Skeletal Muscle Abundant Protein 2, Thyroid Hormone Receptor Coactivating Protein of 120kD, TrCP120, p120, SMAP, SMAP2) (Biotin)

Size

£927.00

SKU:: 123998-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa33-128 from human BRD8 (NP_631938) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3G8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: May act as a coactivator during transcriptional activation by hormone-activated nuclear receptors (NR). Isoform 2 stimulates transcriptional activation by AR/DHTR, ESR1/NR3A1, RXRA/NR2B1 and THRB/ERBA2. At least isoform 1 and isoform 2 are components of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. Applications: Suitable for use in Immunofluorescence and ELISA. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: RSGDQNWVSVSRAIKPFAEPGRPPDWFSQKHCASQYSELLETTETPKRKRGEKGEVVETVEDVIVRKLTAERVEELKKVIKETQERYRRLKRDAEL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice