BRD3 (Bromodomain-containing Protein 3, RING3-like Protein, KIAA0043, RING3L)

Size

£685.00

SKU:: 123996
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa418-556 from BRD3 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6E7
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: The bromodomain is a conserved 110aa motif which specifically interacts with acetyl-lysines, at least in the context of short histone H3 and H4 peptides. Although bromodomains have now been found in more than 40 different proteins, the function of this motif is poorly understood. The association of two N-terminal bromodomains with a C-terminal extraterminal (ET) domain defines the Fsh/Brd subgroup, which includes members in many species. In vertebrates, four members of the Fsh/Brd subgroup have now been identified: Brd2/RING3/fsrg1, Brd3/ORFX/fsrg2, Brd4/HUNK1/MCAP, and Brd5/BRDT. The Brd3/ORFX gene was identified based on its homology to the gene encoding the RING3 protein, a serine/threonine kinase. The gene localizes to 9q34, a region which contains several major histocompatibility complex (MHC) genes. The function of the encoded protein is not known. Applications: Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: EPVEAPALPAPAAPMVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAALSQAPVNKPKKKKEKKEKEKKKKDKEKEKEKHKVKAEEEKKAKVAPPAKQAQQKKAPAKKANSTTTAGRDHFLTCGV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice