BRAF (Serine/Threonine-protein Kinase B-raf, Proto-oncogene B-Raf, p94, v-Raf Murine Sarcoma Viral Oncogene Homolog B1, BRAF1, RAFB1)

Size

£685.00

SKU:: 123989
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa346-445 from human BRAF (NP_004324) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3D2
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: B-Raf, also know as c-Rmil, is a Serine/Threonine protein kinase member of the Raf family which includes Raf-1 and A-Raf. B-Raf is involved in the transduction of mitogenic signals from the cell membrane to the nucleus. Composed of three conserved region (CR1, CR2, CR3) B-Raf is expressed primarily in the brain and in the nervous system. It has been observed that MAPK is activated by B-Raf in response to nerve growth factor. More than 60% of malignant melanomas were found to contain a specific mutation, B-Raf (V599E) the product of which possesses constitutive kinase activity. Mutations in B-Raf have also been identified in lung cancer and non-Hodgkin lymphoma. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice