123989-ML550
BRAF (Serine/Threonine-protein Kinase B-raf, Proto-oncogene B-Raf, p94, v-Raf Murine Sarcoma Viral Oncogene Homolog B1, BRAF1, RAFB1) (MaxLight 550)
Size
£914.00
- SKU:
- 123989-ML550
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa346-445 from human BRAF (NP_004324) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3D2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Extra Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. B-Raf, also know as c-Rmil, is a Serine/Threonine protein kinase member of the Raf family which includes Raf-1 and A-Raf. B-Raf is involved in the transduction of mitogenic signals from the cell membrane to the nucleus. Composed of three conserved region (CR1, CR2, CR3) B-Raf is expressed primarily in the brain and in the nervous system. It has been observed that MAPK is activated by B-Raf in response to nerve growth factor. More than 60% of malignant melanomas were found to contain a specific mutation, B-Raf (V599E) the product of which possesses constitutive kinase activity. Mutations in B-Raf have also been identified in lung cancer and non-Hodgkin lymphoma. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRD Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice